PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00018.1.g00250.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 518aa    MW: 57099.9 Da    PI: 10.7981
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00018.1.g00250.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.91.7e-3195148255
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   prlrWtp+LH +Fv+ave+LGG+e+AtPk +l++m+v gL+++hvkSHLQ+YR+
  Zjn_sc00018.1.g00250.1.sm.mk  95 PRLRWTPDLHMAFVHAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRS 148
                                   8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.60191151IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.0E-2991149IPR009057Homeodomain-like
SuperFamilySSF466895.02E-1494149IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-2295150IPR006447Myb domain, plants
PfamPF002499.0E-996147IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 518 aa     Download sequence    Send to blast
MMRRDLWGTL YHLWYWTSTR ASPRGARKER SATTATRTTT RRQMMTEVAQ AKSSSNNSST  60
NHNSGSNKDH DSSSKAEGSG ERVPTVRQYN RSKLPRLRWT PDLHMAFVHA VERLGGQERA  120
TPKLVLQMMN VRGLSIAHVK SHLQMYRSKK LDHESGHERA AGISSVFSPM DFRMRRGDPR  180
FRDMFLPREP GSALSSSLLQ NSGFFGSRNG VSPDASRIYG LFQHRQPTMR TFDFKNYSSL  240
RNQELMFNHH AATTRVGAIT DHGPAKGLIH NMIFRKDGKP TSHLFDVRDA IASNPSAVAG  300
AANRSSNWDG SSPRPLSRTI SASSSTGFAL ENHHFLSRRR CAGGSNGYHF DTNTTSSDPV  360
VTSEALGTRL EKNLEPKSPN KVIDEMHTAT GTKRPKTSKE VNGWAPDLQL SLSPNEGAEA  420
EKAKKRKVAL SEQEVDTDKM PPLSLSLSLR GGDSGGEGSG GDARRLEAEI GSSSKAAALG  480
LSTLDLTMSI KALESMLFHN HKQHNYTSAL NFSNGISH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965558.10.0PREDICTED: uncharacterized protein LOC101779064
TrEMBLA0A0E0LCE61e-155A0A0E0LCE6_ORYPU; Uncharacterized protein
STRINGMLOC_49594.11e-154(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27543686
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.14e-34G2-like family protein